SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VS60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VS60
Domain Number 1 Region: 50-130
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000197
Family Pointed domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9VS60
Sequence length 600
Comment (sp|Q9VS60|SMSR1_DROME) Ceramide phosphoethanolamine synthase KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=SMSr; OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MCDGEIGDPVTQPRSEGGGLVTMDQETRTHYLDAATDKHLTNGSPDPEPVDPLLVAQWSI
ENVTSWATCMEHFSRTLLDCLRQEAIDGEVLLSLTEEDVRDMRYKLGYKLTFGELKKFWI
AVLKLQLLVKNSSAESVILGIECHGNGNSVYMPLASTGCGPPSSSTCPCPQAECPSYVSD
CDTYLRMGGRYVPPEYFKTAMSLGYSFVVTWITSLTMVIVHERVPDMKRYPPLPDIFLDN
VPHIPWAFNMCEITGSLLFTIWVVVLTFHKYRLVLLRRFFALAGTVFLLRCVTMLITSLS
VPGTHLQCSQKDFAIDDPNVDMVGALIIRMSRAYRIWSGLGMSIQGVRTCGDYMFSGHTV
ALTLLNFFITEYTPRNLYFLHTLTWLLNMFGIFFILAAHEHYSIDVFVAFYITSRLFLYY
HTLANNRALMQSDSKRTRVWFPMFSYFESSVDGMVPNEYDTLGSLIDGIIEQIFKAKDQL
AISVKRCWLDAPLSGNSSAHMFGGESEQCLRNGTASAAFFSPHQSLIGGLGGQRSQTHLN
SAQSGSSTPTPATSAPTKSLPTQKKTFRDASVDPFSRTTFAAVQQAENVKDSPMKEKKHL
Download sequence
Identical sequences Q9VS60
NP_648114.1.81976 FBpp0076580 FBpp0076580 FBpp0076580 7227.FBpp0076580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]