SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VSB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VSB2
Domain Number 1 Region: 802-999
Classification Level Classification E-value
Superfamily PUA domain-like 4.97e-36
Family LON domain-like 0.0058
Further Details:      
 
Domain Number 2 Region: 679-732
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000186
Family RING finger domain, C3HC4 0.0097
Further Details:      
 
Domain Number 3 Region: 354-451
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000121
Family Tetratricopeptide repeat (TPR) 0.036
Further Details:      
 
Domain Number 4 Region: 177-228
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000114
Family RING finger domain, C3HC4 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9VSB2
Sequence length 1066
Comment (tr|Q9VSB2|Q9VSB2_DROME) Uncharacterized protein, isoform C {ECO:0000313|EMBL:AFH04331.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG32369 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MPLSQGYCQQEQQDQGHHMPPSSPIQCYLPHNDSQNSLHYLLAESFAKVGSLPEAFDVYE
LIASRQFDGHVPLDKLNTLASALTTHIRQMGGIATPTPTPTPTPMSAVHVKSPRISERLD
MMPWSRYHHQGKQNQAEQGEFLRGVGESMDEAGDSPLDMHSPTRELRVPSPLQDLEDFDP
LMCPLCSDILRCPVTTNCGHTFCRQCCETITQCNICQVRFPRIQASSPGPPVCALTTTTA
SGAGSSLFTAPSNHNANLSLISFPVGYGVQLSSSVQRLAAPPMTVTTTTVASTTATATTT
MASTSAAAALGLSAYPSAHGGGIGSTAMKFMPDVLVRRLVEKWWGPDLQAKKISEKASSC
MHLNLLDDALKFCNASLEKSPANFKSLCLRAEVLLKLSHYQSSLADIENALRTRCTSPKA
HYLRALALSGLGRLEEALYNGFLAICLDKKTNLSNSEIFQHDLAKILQRLLAHMPKNRTS
LSSATVPVFQQQHRNFATSRAPYPLLWEQVRRRRKQQHHHHHHHHHHHVHLDDVEDEFGH
YNNYIMAGDDMEEEVEVEVEGGEPGSLHLDGDFLFPSALDFMDHHRHQRHVFEQKQFDLQ
PRRHANRKHCKRKWSVAMESMGGKDLEEEDVDRAHAAGESQRCSRLFAGVLDRTQQELQR
LKKLDKSAPSLAVSSVAGQLIDASDFDCVVCSRTLWKPVVTPCGHTYCLVCLDRCMDYNS
PCPLCMSPLVEFNVNASASTSASQHPNPNQNQIHLHPGSSSPVPFALAKRPVTKFLEAAM
KRFIPDHYEARFRQEIDQEPSVPVFICTAAFPAVPCPLFVCEPRYRLMVRRAVESGDKTF
GIVQPNGGKSRYYDVGTILDIRDCVQLGDGCSILSTIGCKRFKILARNEKDGYETAKVEY
ICDEPIADEQVKILAGMQGVVLAKASEWFESLSTEQKHEILQSFGQMPPLEPNWELISDG
PAWAWWIIALLPLSQQLKVDILATTSLEKRLRAIDKTLDWLHDLSHPQQPAHHPMNHHQQ
APQSPQQAHHLDLDCEEQEGASSGSDECCLFAETGNEPHTDEELLL
Download sequence
Identical sequences Q9VSB2
FBpp0076499 FBpp0076498 FBpp0293529 NP_001246660.1.81976 NP_729296.1.81976 FBpp0076498 7227.FBpp0076498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]