SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VT44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VT44
Domain Number 1 Region: 170-499
Classification Level Classification E-value
Superfamily L domain-like 1.43e-50
Family Internalin LRR domain 0.029
Further Details:      
 
Domain Number 2 Region: 77-186
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000000111
Family Internalin LRR domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9VT44
Sequence length 552
Comment (tr|Q9VT44|Q9VT44_DROME) LP04042p {ECO:0000313|EMBL:AAM50873.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG6749 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSQTANWVLPLLLWLLCMGFPILHGADLCQPIGWRNFQCSEVASLQDLVDLGAENWHTLA
IRNVQTELEVGSGENADHLANLLDLDLTGAAPINVHTNGFSILPNLRQLNLSGCGLVDIR
GNHFAPESALQRIDFSHNQMELLDRDFFGNLRKLIYANFSHNALKQCDLPHMPLLNRLEL
GHNRLVNATFGVCPQLQELILNDNQLIQLDVNAFRGLHGLLELQLSGNRLSSIGLETFQP
LAQLRKLNLSQNALDALRPNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLD
VSRNSIASLSPAHFVGLGSLRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQ
IFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQK
LHLGHNLLEEINLDVLESLSSVQEILVDNNRLTFLAKVNVSFPNLKRVAIEGNPWQCPCF
VKLQHWLATRDVVYLRDNTGYYKGERPLCIVTNVDYCIQNLQAVRRLGILGDFQGEQVEA
DAFDDDASAAQD
Download sequence
Identical sequences Q9VT44
FBpp0076139 7227.FBpp0076139 FBpp0076139 FBpp0076139 NP_648354.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]