SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VT94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VT94
Domain Number 1 Region: 288-346
Classification Level Classification E-value
Superfamily RING/U-box 1.39e-20
Family RING finger domain, C3HC4 0.0000853
Further Details:      
 
Domain Number 2 Region: 139-217
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000766
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Domain Number 3 Region: 208-276
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000296
Family IBR domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9VT94
Sequence length 511
Comment (tr|Q9VT94|Q9VT94_DROME) RING-type E3 ubiquitin transferase {ECO:0000256|SAAS:SAAS00970528} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG12362 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MNSEMEFSDEDHGDSHRSLLTHMSCENDSDSEDTCTEILLPENSNSPETEDFVYKVLSVD
QIVQHQRNIIDEVNNVLNLPPQVTRIILNHFKWDKESLFENYFESNPKDFFQRAHVLNPF
EKKIERESAASTSCAIPQLCGICFCSCDELIGLGCGHNFCAACWKQYLANKTCSEGLANT
IKCPAANCEILVDYISFLKLADDSEVVERYQQLITNTFVECNMLMRWCPAPNCSHAVKAV
CAEPRAVLCKCGHEFCFACGENWHEPASCSSLKKWVKKCLEDSETSNWIAQNTKECPKCN
VTIEKDGGCNHMVCKNPSCRYDFCWVCLGSWEPHGSSWYSCNRFDEEEAKQARLAQQKYR
SSMARYLHYYNRYSNHMQSLKMENKLYSNIQAKMDDMQEEMSWIEVQFLRDAVDVLCQCR
TTLMYSYVFAFYLMNNNQKIIFEDNQKDMEMATEKLSECLEREITVKNIYEVKQKVLDLS
HYCQKRRHVLLCHVREGYENDWWEFKEETTT
Download sequence
Identical sequences Q9VT94
FBpp0076010 FBpp0076011 NP_648392.1.81976 NP_729606.1.81976 FBpp0076010 7227.FBpp0076011 FBpp0076010 FBpp0076011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]