SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VTL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VTL6
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 1.44e-19
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.002
Further Details:      
 
Domain Number 2 Region: 79-160
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000933
Family Cold shock DNA-binding domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9VTL6
Sequence length 240
Comment (tr|Q9VTL6|Q9VTL6_DROME) GM16372p {ECO:0000313|EMBL:AAM49848.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG7339 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MFVLAELKDNVRIAPDQFHLKLVDAVRDEIDRKLANKVLLNVGLCIALKDIVSLKDSIIL
PGDGASHTEVLFRYVVFRPMVGTVITGKIRNCSREGVHVTLGFFDDILIPHAALQHPSRF
DEAEQAWVWEYPLEDGAKHDLFMDVGEPIKFRVSREIFEETSPIGPPKTEAQTQQGASTS
AAVASATSQEVKTPYRIIGAINESGLGVLSWWDQQGKDDEQDDEEDEEYDDEDGEGACEE
Download sequence
Identical sequences Q9VTL6
7227.FBpp0075838 FBpp0075838 FBpp0303920 FBpp0075838 7294695___KOG3297 FBpp0075838 NP_001261720.1.81976 NP_648490.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]