SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VTZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q9VTZ2
Domain Number - Region: 40-103
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00223
Family Single strand DNA-binding domain, SSB 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9VTZ2
Sequence length 214
Comment (tr|Q9VTZ2|Q9VTZ2_DROME) Verrocchio, isoform B {ECO:0000313|EMBL:AGB94470.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG14121 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MDFNQSFEDIESQLDNFVIRKNQQSEKSTGKCGPEVHDNVPLTISQIERATQDPENENVF
ITDDVHPIHFCTCIIYAFVTGNGTHNESFMKFMIDDGTGSLEASITKKPFNGRVISSLYS
EASSLASSEAYKSIAVSMMRLLQVSMEYIDPTRISRGHSLFLRGRPNRFRGKMGLDAFQF
FIDSGRSRNMEIGFVDYLTDWQRRHKTMQNTTNK
Download sequence
Identical sequences Q9VTZ2
NP_001261777.1.81976 NP_648587.1.81976 FBpp0075692 FBpp0304177 7227.FBpp0075692 FBpp0075692 FBpp0075692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]