SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VUE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VUE3
Domain Number 1 Region: 107-161
Classification Level Classification E-value
Superfamily RING/U-box 3.3e-16
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9VUE3
Sequence length 176
Comment (tr|Q9VUE3|Q9VUE3_DROME) IP04153p {ECO:0000313|EMBL:AAY55400.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG13481 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSSNSSESLNKMKSLVGKMIFMQVTEHLFLRAQQLLDSDVSIEERVRRMEVLNNNMKWFN
SERTRILEQLQLNIFGQISVEHHNAMNMSENLYELREGLDGLSRRMESMQEDITCSICLS
PWSSNGRHRVVSLRCGHLFGNSCIRTAIRRSHRCPICRRRALHADVRRIFSRRISH
Download sequence
Identical sequences Q9VUE3
7227.FBpp0112083 FBpp0112083 FBpp0112083 FBpp0112083 FBpp0305236 NP_001097605.1.81976 NP_001261837.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]