SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VUV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VUV7
Domain Number 1 Region: 193-315
Classification Level Classification E-value
Superfamily NRDP1 C-terminal domain-like 7.45e-60
Family USP8 interacting domain 0.00000457
Further Details:      
 
Domain Number 2 Region: 3-90
Classification Level Classification E-value
Superfamily RING/U-box 3.09e-19
Family RING finger domain, C3HC4 0.03
Further Details:      
 
Domain Number 3 Region: 79-151
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000000000981
Family SIAH, seven in absentia homolog 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9VUV7
Sequence length 315
Comment (tr|Q9VUV7|Q9VUV7_DROME) LD41235p {ECO:0000313|EMBL:AAK93355.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG17033 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MGYDVNRFQGEVDEELTCPICSGVLEDPLQAVMCEHAFCRGCINEWLTRQPTCPVDRNSL
TTANLRAVPRILRNLLSRLSITCDNAPYGCTAVLKLDAYNSHLDECIHNPKRPFPCEKGC
GFDIPKDELKDHNCVRELRTLIVKQTEKMGELKSELTDQQLTINELKRELQLFKDFMRAM
RVSNPAMRAIADQMERDEVIRWSSTLPRARVTRWGGMISTPDDALQLMIKRALSESGCPP
HILDSLMEFCHERRWPRGLSSLETRQTNRRIYDNYVCRRIPGKQAVLVLSCDNLHMTEDV
MIDPGLVMIFAHGIE
Download sequence
Identical sequences Q9VUV7
FBpp0075265 FBpp0075265 7227.FBpp0075265 FBpp0075265 FBpp0305750 NP_001261904.1.81976 NP_648816.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]