SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VV73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VV73
Domain Number 1 Region: 572-776
Classification Level Classification E-value
Superfamily NTF2-like 2.19e-33
Family NTF2-like 0.0064
Further Details:      
 
Domain Number 2 Region: 420-565
Classification Level Classification E-value
Superfamily L domain-like 4.76e-16
Family mRNA export factor tap 0.0069
Further Details:      
 
Domain Number 3 Region: 164-285
Classification Level Classification E-value
Superfamily L domain-like 0.0000000238
Family mRNA export factor tap 0.045
Further Details:      
 
Domain Number 4 Region: 792-840
Classification Level Classification E-value
Superfamily UBA-like 0.00000156
Family TAP-C domain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9VV73
Sequence length 841
Comment (sp|Q9VV73|NXF2_DROME) Nuclear RNA export factor 2 KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=nxf2; OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MPNQMRVLDFGDGSVPIQLDYPDSKIFSKCSSYGDRVPGTHWNEITVHHKGRLEYSPNPE
QIILDALYQAIDGADFFPVFYQRGKNMDTMLVRNCKAAIDKLFKQRLSINLKGGASIPIS
IQLGVAQYQRHQITPTFHIARVVTRLMKQLIQRDGVDGLLNLDNFGSHPEFKNLVVSLGN
PSILMNVCQVIHNDDNERFRLNGFILSNNRIRDIRPLTLLANVDYALLDLRGNKIKSAER
LCRALEQFRARELLLENNPIVKISNFPANIKSLESNFELVDGKPFNMLHKIFSPLDVEID
LEVDGARIDTNNMWKLPEFENSQHWHAFMIPDPSHEFNQEVFFDFFFIRLDPTLSNFYPC
YYKYINTEHVFLVRNCFDQIAHLVNNCNLEMTIPTGDRIFRYYLRMNVSTVKQHHVDPEE
CIQKAVSQCYVAQNRMLNLERFHSRECLKDVMVSLSSPKILTYVLSVASRKFMTTCSEIR
LCHNKVLVLDGAHVLGMMGCLRAVDLSHNWVQDLSSIHSLGNLPLKSLVLHGNKLCRNYR
LPSEYVRAVKEVFPQLTTLDGVDLQTNPGQSLQKNFLCDTGAYELVGAFLENYLREFEND
EFRHNLYKYYSENSIFTLTCNYNVVQNHQTPKILQRLSKYNRHARNLRNKDYSKASDGVF
FGCTYIVEILLQLPRVTHDFHSLQTDVMHYNGKGAVIYVAGLLRDEPPSTRNGHGSKTDI
GGVLLGFSRQFVVTFDEANLGLGKRARRLKIANERLHITNPSKTAIRNAFSVNFPDPSER
QAEEDSLDVKDHKLLLFQEVTGLISTWVTSIVEEADWDFERALKLFIQKNADHEIPDLAF
A
Download sequence
Identical sequences Q9VV73
7227.FBpp0088483 FBpp0088483 FBpp0088484 FBpp0088483 FBpp0088483 FBpp0088484 NP_524111.3.81976 NP_730179.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]