SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VVU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VVU5
Domain Number 1 Region: 384-464
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000212
Family PCI domain (PINT motif) 0.046
Further Details:      
 
Weak hits

Sequence:  Q9VVU5
Domain Number - Region: 190-231,274-358
Classification Level Classification E-value
Superfamily TPR-like 0.00209
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9VVU5
Sequence length 525
Comment (sp|Q9VVU5|CSN1_DROME) COP9 signalosome complex subunit 1b KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CSN1b; OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MPVLPMPPLMQNAVEPMQVDIAPPNEDNENNEEQQIVVENPSIDLEVYANQYAGIVRLHR
LIYVADVCPVLAVEALKMAITYVQTTYNVNLYQVLHKRLSDLNAGNAPAPPANAGGDQAG
AAAPGPLAAAPLPDIAAQPVAQAQGQAQPAVEKDAFAYDAAWVDTKMKKAALKLEKLDSD
LKNYKSNSIKESIRRGHDDLADHYLSCGDLTNALKCYSRARDYCTSGKHVVNMCLNVIKV
SIYLQNWAHVMSYISKAESTPDFAEGSKEANAQVHTRLECAAGLAELQQKKYKVAAKHFL
NANFDHCDFPEMISTSNVAVYGGLCALATFDRQELKRLVIASTSFKLFLELEPQLRDIIF
KFYESKYASCLTLLDEIRDNLLVDMYIAPHVTTLYTKIRNRALIQYFSPYMSADMHKMAM
AFNSSVGDLENEVMQLILDGQIQARIDSHNKILFAKEADQRNSTFERALIMGKQYQRHTR
MLVLRAAMLKSHIHVKSISREGGSNHGAELCVSAGSSTTAQLARI
Download sequence
Identical sequences Q9VVU5
NP_524152.2.81976 7227.FBpp0074841 FBpp0074841 FBpp0074841 FBpp0074841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]