SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VW34 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VW34
Domain Number 1 Region: 168-476
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.78e-39
Family NodB-like polysaccharide deacetylase 0.014
Further Details:      
 
Domain Number 2 Region: 65-107
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000123
Family Tachycitin 0.015
Further Details:      
 
Domain Number 3 Region: 122-159
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9VW34
Sequence length 541
Comment (tr|Q9VW34|Q9VW34_DROME) Serpentine, isoform C {ECO:0000313|EMBL:AGB94755.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG32209 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MAKLFVVFAVLALAAFNEASASDPLLRYKRQATTEETKKEESFEKELCKDKDAGEWFRLV
AGEGDNCRDVIQCTSSGLQAIRCPAGLYFDIEKQTCDWKESVKNCKSKNKERRVKPLLHT
DEPLCQDGFLACGDGNCIERGLFCNGEKDCSDGSDENTCDIDNDPNRAPPCDPAVCVLPD
CFCSEDGTSIPGDLPAKDVPMMITITFDDAINNNNIELYKEIFKDRKNPNGCSIKATYFV
SHKYTNYSAVQETARKGHEIAVHSITHNDEERFWSNATVDDWAKEMAGMRIITEKFANIT
DNSVVGVRAPYLRVGGNNQFTMMEEQAFLYDSTITAPLSNPPLWPYTMYFRMPHRCHGNL
QSCPTRSHAVWEMVMNELDRREDPVNDEYLPGCAMVDSCSNILTGDQFYNFLNHNFDRHY
DQNRAPLGLYFHAAWLKNNPEFLDAFLYWIDEILANHNDVYFVTMTQVIQWMQNPRTISE
VKNFEPWREKCVVEGKPACWVPNTCKLTSKEVPGETINLQTCVRCPNNYPWVSDPTGDGF
F
Download sequence
Identical sequences Q9VW34
7227.FBpp0074721 FBpp0074721 NP_001262062.1.81976 NP_730444.1.81976 FBpp0074721 FBpp0305995 FBpp0074721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]