SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VX50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q9VX50
Domain Number - Region: 406-442,484-510
Classification Level Classification E-value
Superfamily TPR-like 0.0043
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9VX50
Sequence length 538
Comment (tr|Q9VX50|Q9VX50_DROME) Presidents-cup {ECO:0000313|EMBL:AAF48730.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG12993 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSWTSGLYKSLLLRSQQSLVRPDLALLDIQISKRAIETMFGHRRELSFNHSHTADIIAKK
CEELFNANEFENALTTLYTDGRPFGGQFAHGRFEMIKQRSLAVFEDTLGESLRPFMHQHR
DVLEQINRRQKELAAHVSRPLWKKLRDQQQCDVQSIIIKERPQLTLLEKARRRASESLYN
HNYLGRSAVDIALLRQLRSDRNFLDPLRLATTPPMRKLTRRQFTIVRRLMKMLQARNPLY
NRRYVQQRHGPIADQERRRWQEMHLFHAQYQTRRDCMRMLHEVHKRRREGDVEKLSDYVE
NIMSGFIEYKTHRTLPWKFEFINEVYNILALAYCDKCAVPANVDFLQAQNRPILYLLRTE
KLHDMSVQFGGPNIYVEIEKEDERHSRISQKLEQLENRLRHSRFAIERSYLLFEIARCHF
QESRFDKCLVVARKAFNEARSCNCLIWRFNSIFLGCQVHAVLNRFERLKESLAKASQLAS
ELQAPKLVAYIAICINVNNYDLALQRIRQSDGNKRKSRKRSPVSTITSNSSQGSMSST
Download sequence
Identical sequences Q9VX50
FBpp0074211 FBpp0074211 FBpp0074211 NP_573216.1.81976 7227.FBpp0074211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]