SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VYT2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VYT2
Domain Number 1 Region: 165-289
Classification Level Classification E-value
Superfamily TPR-like 1.9e-22
Family Tetratricopeptide repeat (TPR) 0.001
Further Details:      
 
Domain Number 2 Region: 10-91,124-149
Classification Level Classification E-value
Superfamily FKBP-like 3.14e-16
Family FKBP immunophilin/proline isomerase 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9VYT2
Sequence length 320
Comment (tr|Q9VYT2|Q9VYT2_DROME) HL02936p {ECO:0000313|EMBL:AAL48489.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG1847 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MQSRSKSDMKPIRKEILNPGNAYIELTPGTRVKFHFQTRRAGDSRIIDDSRKMEKPMELV
LGKKFKLEVWELIVQQMSLNEVAKFTVHKSLCAQYPFISKTLRDIGKKPEERRHCCGMTL
QNEGIGYTDLDELLQNPSDLEFIIELFSIELPEQYEKERWQMSDDEKMLATSTLRERGNN
FYKASRFTEAETCYREAVGIVEQLMLKEKPHDEEWQELAAIKTPLLLNYAQCRLIAGDFY
AVIEHCNEVLTLDPRNVKALFRRAKAHAGAWNPAQARRDFLDALALDASLKSTVSKELKS
IEDQQQARNVQDRIHMQKLF
Download sequence
Identical sequences Q9VYT2
NP_572758.1.81976 FBpp0073411 FBpp0073411 FR722 FBpp0073411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]