SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VZ22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q9VZ22
Domain Number - Region: 543-596
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00055
Family PHD domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9VZ22
Sequence length 602
Comment (tr|Q9VZ22|Q9VZ22_DROME) RE35228p {ECO:0000313|EMBL:AAL48955.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG1908 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSKYHKERKYAKFRYYMEKYYVLPLELKNDIIYCQRSLRDFLKVHALVSEVFDEQADADP
VQMRRILDELEEEVYEINAEQQFLLLRLNDSLQEFSVKLKENNIMFLPDIAHEYVSAQVV
PLIVDPNYKIMPQSVMARDTEEMLIRKHFLLSQDDDSGMPPLKLSELDENIPLMLAPPVR
GLGQQIAAVKPEPEWLQGDEATVSVPPPPPQSKSKLMKGSLDSTPAKRENISRSSPPPLA
PITQTVVAELSQVPPSPQAESPPVNFHVVAQSRKNLQQALRRARKTKQQPRLFDDEEDLE
ITSLQNDRNKNRTSDGKGTPPSLEPTNAAANQAAKKTIPQMSSQGMAKNNTAKSKNTCRK
SSPTPTSSGQSQPAVSSSGSSDDSSAELQQEQQRRVASAAQWRDEPRESRTQPEEYGQET
FLGLFELYSPEVLKKLSQRHSKRKRRTVQNASGVDFHYGQQLNAVDALVMGVRGQKKTKE
KSEFLLSPTEKRLQANSKRTYTRKSKSPDEISEKSSAGGGSGASGTASSSACQHKDGGAS
KCRKCRECRECKRRVETEAMYCHLCSGLYHMDCHEFTKNRQLMQLQNSRCPPCLREKDKL
EK
Download sequence
Identical sequences Q9VZ22
FBpp0073296 NP_001285113.1.81976 NP_572692.1.81976 FBpp0073296 FBpp0073296 7227.FBpp0073296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]