SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VZF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q9VZF2
Domain Number - Region: 71-108
Classification Level Classification E-value
Superfamily RING/U-box 0.00671
Family RING finger domain, C3HC4 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9VZF2
Sequence length 840
Comment (tr|Q9VZF2|Q9VZF2_DROME) LD05244p {ECO:0000313|EMBL:AAX94784.2} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG15011 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MEKFNKAQAKNLAAAQKLVDTYASSSEDEGELDENHILELLYKNYKPSDNAGSSKEAART
STFLENTLHSGAATCLICIGSIRRVEAIWSCESCYCFFHLKCIQRWANDSMMQMKVKAAE
QQNGQGHYNHLGEFVPPKRQKSLHWCCPKCRRDYQPADKPTQYNCFCGKEVNPENQPFLV
PHSCGEHCGKLLQPKCGHDCKLLCHPGPCPPCAQQAQVSCLCGKSSPRSVRCIDKQWTCQ
QTCKELLACGKHKCNQVCHQPGKCPPCTSKSLQPCECQRESKMVNCSDRKWKCQNVCGAP
FACGLHICEKVCHAGPCGDGECPLQVRSCPCGKNTQVRPCNETEETCGDTCQKLLSCGQH
TCTQRCHRGPCISCPIRTKKKCRCGLHEKELPCSKEFACETKCKQMRDCGKHACNRKCCG
DQCPPCEKICGKQLSCNKHKCQSVCHNGPCYPCKLESQINCRCGKTKKSVPCGRERSARI
VCLELCRITPKCHHAIKHRCHKGDCPPCGQVCGLPNDTSKCGHICKARCHEAVRVNKPKE
ARPQAKKYEYKALPHPRCEEGVIVTCIGGHEVATWPCWNSKPTSCQRSCARQLKCGNHKC
SLVCHFVPLPQDMSAQTGCANCEEGCTVPRPTGCIHACPKGCHPPPCAPCNFVIKTKCHC
GLNQLVYKCNEYYDETGSVQEIIERREKLRSCGNRCLKNYPCGHRCTAICHTGKCPNPEL
CRKKVRIFCACKRLKQEIACDKHRAGQTFLDCDSNCKAEQIRVQAAEQLQLEQKRRDEEE
RNRLELEKFEAKFGKRKHKERKTVGSGPAKTKIDWQRRAIYAVSILTVVGAIVVAFYADS
Download sequence
Identical sequences Q9VZF2
NP_647879.1.81976 FBpp0073100 FBpp0073100 FBpp0073100 7227.FBpp0073100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]