SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VZJ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VZJ9
Domain Number 1 Region: 283-332
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000471
Family RING finger domain, C3HC4 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9VZJ9
Sequence length 338
Comment (sp|Q9VZJ9|MUL1_DROME) Mitochondrial E3 ubiquitin protein transferase 1 {ECO:0000305} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG1134 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MEFLHESVALGVDLLILGLCAREYVHYKRTAKVLKAAPQYNIDGDLKSVVERQRDKKIPY
AVIRGTVTPIGVPLRSSLVPSVSGVLQIVKLHEHRVTRGFAGFWTEQHKLLHESANEMPF
ELRNQSHGVEIVDALSAAVLDVDVVYDNYEPSNLSLFDHVFGFFSGVRQRGLQTTEEVLR
EGSFLTAIGELELDGDTLRMQPSNEGPLFLTTATKSTLIKRFEDAKTTTILKLVVCSTIS
AILVAFIAKKLYRKRKQEREEAKIRERLDTERRERRARSRPHTLSQDQLCVVCSTNPKEI
ILLPCGHVCLCEDCAQKISVTCPVCRGSIVSKAAAFIA
Download sequence
Identical sequences Q9VZJ9
FBpp0073049 FR472 7227.FBpp0073049 FBpp0073049 FBpp0073049 NP_001303365.1.81976 NP_647847.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]