SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VZK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VZK5
Domain Number 1 Region: 100-147
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000376
Family RING finger domain, C3HC4 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9VZK5
Sequence length 163
Comment (tr|Q9VZK5|Q9VZK5_DROME) IP04615p {ECO:0000313|EMBL:ABE73316.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG14983 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MLHLPKIVDLLKELQEQEKEIQEIILEESFASPEQRLAQLESVTSRMHLYHSRRGNILMS
LQQELGKYEYFTLLVRHIAQTHSYLKSLNKALDFLYKVNICSICDLKCEPHGRHSMVSLR
CGHLFGRHCINNVLRESSRCPTCSRRARHHEVRRIYGLKFYPL
Download sequence
Identical sequences Q9VZK5
FBpp0073027 FBpp0073027 NP_647843.1.81976 7227.FBpp0073027 FBpp0073027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]