SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9W0D8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9W0D8
Domain Number 1 Region: 196-257
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000048
Family RING finger domain, C3HC4 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9W0D8
Sequence length 708
Comment (tr|Q9W0D8|Q9W0D8_DROME) LD09551p {ECO:0000313|EMBL:AAL28656.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG12099 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MDSNNSSNSKKQPQSSHHGKSSSAESQRKSSELHTNSNKQRHSRRRNQVPTPRNDQQQQP
QQPAKLRPNVDKRPKARGFGGGYDFPSPRGQDGASGSSRLAYSATGYSRSGDFDHELNSV
YTQGSKKQNLNHLLNFHCVPRELERGHHHQAQQHHGLSGRKQRYNKEQFLQANFQFVIRS
GAKAQVNGSPDALIDWSYIEQINIQTTEELQCPICLYPPVAAKLTRCGHAYCWPCLLHYL
SLSDKTWRKCPICYDAIHAGDLKSCTIEQLRDLQVGEKITFQLMRRRKGSMYIENHVAGL
GETIERFPFVSAGEEAKRYSKFLIAKRMDVAAIIERERNELLAESDVSCPEDVFIQQALV
MLQERVEKLGVEKPDPKEDEEETAPVLCLETETKIDIEKSDDASISSGEASSSLSYSSNH
NKYYYFYQSNDGQNIYLHPLNVKMLQACYGTLDLGPLLIEAQIVQMEQHSMDEEHRRKFT
CLGHLPLTCQFSVVEVELQPPVVTGGILKLFKEDILHRKKERQRRDREERKREQHINEIN
DRQMGKLIASAANLDLSSSHEFPTCGFEEALPAPSGSVPMNISNQDPGSRYSSVTLGSPK
QEMWPTIGSNSPGGGGAPLDVQVGAWGRSAPPPPRAVMVPRTSDEDFEQRSVGHWGLGEL
LVGALDQKKQKVGAAKSNGAAPAESKKQKKAKGKKMVPLFATGMNRAP
Download sequence
Identical sequences Q9W0D8
7227.FBpp0072708 NP_647623.1.81976 NP_728629.1.81976 FBpp0072708 FBpp0072709 FBpp0072708 FBpp0072709 FBpp0072708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]