SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9W128 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9W128
Domain Number 1 Region: 89-379
Classification Level Classification E-value
Superfamily L domain-like 3.27e-36
Family Ngr ectodomain-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9W128
Sequence length 469
Comment (tr|Q9W128|Q9W128_DROME) RE54577p {ECO:0000313|EMBL:AAL49087.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG4781 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MARLEVIRGLTFALLLTQLLAAHVARAEVIDAEETDRFCYPESSKNSRRSCECSNVSASP
WGNRALRIDCSYKDYKVADLSLLLPLYIDSLDLSWNALDSVPIFTSDSLHQLNLRHNNIS
QLVSGNFKQLTSLRELYLGWNSIGKLESGSFDGLPHLQVLDLAHNNLHLLPGHLFAPLLV
LGTLDISWNRRFNESGGDLYTGLGVNWKLSTLRLDACSLNDLHLPVNAPLKELSLRRNQL
KRIPTQLPETLLRLDISDNLLEELLPEDTANLTQVRQLFIEDMPVLQRVVANSLTHVDVL
ETLSFQNSRQLSHLDAEAFGPIMTTPTKKRALRSLSFRGTMLRTFNSTLAPIFTQLAELD
LNGLPLQCDCELVWLKQLPVQTNGRCYKPARIRGMLVTSARGDAFSCDTWPRWAYGLVVL
SLIALSAAGIYLIVMGLRPHRGVTMRRKVGAGSPYARVTIEPNRQENPH
Download sequence
Identical sequences Q9W128
NP_611951.1.81976 FBpp0072242 7227.FBpp0072242 FBpp0072242 FBpp0072242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]