SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9W1Q6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9W1Q6
Domain Number 1 Region: 122-498
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.8e-145
Family Myotubularin-like phosphatases 0.0000000332
Further Details:      
 
Domain Number 2 Region: 3-113
Classification Level Classification E-value
Superfamily PH domain-like 9.22e-18
Family GRAM domain 0.024
Further Details:      
 
Domain Number 3 Region: 622-685
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000317
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9W1Q6
Sequence length 689
Comment (tr|Q9W1Q6|Q9W1Q6_DROME) RE56001p {ECO:0000313|EMBL:AAX33406.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG3530 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MDEIKLAKVENVRMIDRYNTKNPTVGTLYLTATHLIFVEPDSNKETWILHMHVASIEKLP
LSTTGSPLLIRCKTFLSVTFVIPKDSECHDVYTSLLKLFQPVSINKLYCFNYQPNKDDFP
KNAGWDYFKLEAEFKHMLVPNEAWTLCSMNEKYELCDTYPRQIYVPKEATTLMLISSSRF
RSKGRLPVLTYLHNNKASICRCSQPLSGFSARCLEDEQMLEAIRKTNSNTDYMYVVDTRP
RINAMANRAAGKGYENEAFYENIKFHFLGIENIHVQRASLQKVLEACEQKSPTMSAFINA
LESSGWLKHIRSILDTSSFIANAVDKGVSVVVHCSDGWDRTAQVCSLAQLMLNPYYRTIK
GFQALIEKDWLAFGHKFSERCGHIQTDAREVSPIFTQFLDCTWQLMSQRSEAFEFNERFL
LILHDHVHSCQFGTFVGNCEKDRLDLKLAERTFSLWGYMANHLNEYINPLYKPNVDEAIK
ANLAPQCIKFWRGMYSRFESGIHPREPLGDVLLDSKEHCNSLEDHVQHLTKRIASFKNYI
SKSAKKLQDATSAPGKVNKELSSNEINDNKYNYDKKLSELSAADDDHPLKASNMSFASLS
LSAEQSSPPQALPEEINSVAVDWKPMRNVTTCSCSTPFDQFSKKTHCWRCGDIFCERCID
KNVALPGHDSGKPVPVCRGCFRQMQKQSP
Download sequence
Identical sequences Q9W1Q6
NP_611791.2.81976 FBpp0071937 FBpp0071937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]