SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9W1S2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9W1S2
Domain Number 1 Region: 8-116
Classification Level Classification E-value
Superfamily Bromodomain 3.66e-31
Family Bromodomain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9W1S2
Sequence length 268
Comment (tr|Q9W1S2|Q9W1S2_DROME) Testis-specifically expressed bromodomain containing protein-3 {ECO:0000313|EMBL:AAF46981.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG30417 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MAAKQETERSSPEINACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDL
STVRHRLNTGCYLSAADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQVQLY
ICSSGSKVRAEEESSSDESDSSSPEDEVNGSEVSPSIMGAPPSCTPTTECTPTPDWTPPA
TLETSEQQEPFTTEEDLDLHAKIQQLDGEVLLHVIHFIQRMEGAEYCNKELEFDICKLKV
HTKRGIRDYLASKGFTGKRVARTKPKYN
Download sequence
Identical sequences Q9W1S2
FBpp0071950 NP_726307.1.81976 FBpp0071950 7227.FBpp0071950 FBpp0071950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]