SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9W1T9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9W1T9
Domain Number 1 Region: 460-673
Classification Level Classification E-value
Superfamily TPR-like 1.52e-17
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 
Domain Number 2 Region: 123-300
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000142
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 
Domain Number 3 Region: 310-448
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000673
Family Tetratricopeptide repeat (TPR) 0.0082
Further Details:      
 
Domain Number 4 Region: 650-735
Classification Level Classification E-value
Superfamily TPR-like 0.0000011
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9W1T9
Sequence length 922
Comment (tr|Q9W1T9|Q9W1T9_DROME) CG9899 {ECO:0000313|EMBL:AAF46964.2} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG9899 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MEKMLSTYIEEAMEFYAIGKGADFKAIIEKGIASCMTTYSTYDRELYKAYALLATYLSNH
AFKIIKSRPAFQAMAINCFDQLDSLRQQHDPHLQVTKGFLWMLSSSRAQDADALLISVLR
NHPKNILALIGRACLAYNRQDYIGALGYFKSVLLIQPQGMADVWVGIGHCFWKMGELEKA
QLSFQIALEHNGQCLNAALALALVKFEHNDEQSYQDGKMLLTAAYKENNKNPDLLSILAG
MYYADGNHKLVWSFAGNAIKFTANKHIESRNYFQIAKSYHATGQFESAKKYYLLSAKSAP
DGYILPLVGVAQMYLHEGELNRSKAFLESFLTSEPDEPVVMDLLAKIYLEYKCPEKIDKA
IEMLVKVVESASYHQNTNSWLNLAFAYEQKRLWAHGVNAYQKAIDIYLSQGHQIPIEWLN
NLASSQLMAKMPEKALNTLDDALSKCRVMNSDNKTTNLLSLQYNRGLVLEELHMFTLAAE
NYKSITKEYSSYHDCYLRLGVMAIQKNNHTQAIEHLKDILVEDNLNMTARTYMGDCFKGL
SLDKFATFNYNMILARQSKFTNTYVSMAMGNFCLEKLQNWIAEGNFRAARKQQEKALQCF
GKILDCNPKNLWAANGIGAVLSSCNNLSAGGAIFKQIIECGNKCIPAIINSAHIALVSGQ
YRLAIQTYERCLKDHLPKNRVDVMHCLAKALYDNGDARKAKMWLLKVRHLVPHDPFVIFN
LGLAIKKETEQALALPRPQLDELMGLDGLLKVAFKLFCHINLNHPKISVRVSAKYAEDCQ
NLMTELIAKKRQASESHAMEEDRVQLQKQRYRDHIEHQRQQELQREEEERVRRENLKIQR
KEVLERTRKIISAPLAPDVPKKSAGNGRAKKNQENGDGKAKKSGPPKKKTRKRAAGKEQE
DIEPLKKPKSKEFIDTDDDNSE
Download sequence
Identical sequences Q9W1T9
7227.FBpp0071879 FR728 FBpp0071879 NP_611764.1.81976 FBpp0071879 FBpp0071879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]