SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9W266 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9W266
Domain Number 1 Region: 46-216
Classification Level Classification E-value
Superfamily L domain-like 8.5e-21
Family Ngr ectodomain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9W266
Sequence length 677
Comment (sp|Q9W266|WDP_DROME) Protein windpipe {ECO:0000303|PubMed:11804792} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG3413 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MERVHLTAWLALFLIVVANATPTPARTPTGCPADCTCSLSQHTHKPLYHLKCNSTRGLRL
TEKTFQSTVPVHSIDLSHLNLTRLSHLLDKLPELTSADLSHNQLKDLGHLGKGLKRLNLK
HNQLTSDKLRKLPQHLQVLNLQHNNITHLPLELTHMHQLHQLELSHNAINCSCQTLEVRN
WLVERIVYMEHPVVCSYPLEFRGRSWLQLKQDEICKKEKYQWFDTEENELMMGDQPAAVS
AEREDEEELGKDFLPIVGNPAATAKKVRSPQIPLPSDQVEGSGDLSETNMELKLPEETVA
EPEAAESQLVDAAASPSVLEEHIVKDEDEDDEGSGSGGGLLIIPDPSKVKITSEDDIDSD
GKPEESDVRPLENPENSENPDTVFSNKIGIYEGDQEEKKPVEEDNIVPVVMTNLDTGLES
DVVTDGPLDSSKESEDILTAKIGKPKDDSSAIYYLLAVIGLIVVGLVLFVAIKRCKYDSN
AAARDAEAQRQTELLDMDKKQLGKPLHKNGHGNGQEHSPLIGEKTKLDEAQIVKKPYENG
EAKDGAGQQPLLNGNGSANGGTKEAPETGEPAAHEYYPITPRYPTPQSPRASKYAQQQQL
AEQNNNEPDGAYLPSSPKSGRYSPVYSPETGRVKIKLTETPKPKTPMLVTRSKSNAGDII
TTPVRPIEPTHQVINGH
Download sequence
Identical sequences Q9W266
NP_001286712.1.81976 NP_611661.1.81976 NP_726187.1.81976 NP_726188.1.81976 NP_726189.1.81976 7227.FBpp0071762 FBpp0071760 FBpp0071761 FBpp0071762 FBpp0071763 FBpp0071760 FBpp0071761 FBpp0071762 FBpp0071763 FBpp0071760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]