SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9W2U2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9W2U2
Domain Number 1 Region: 48-277
Classification Level Classification E-value
Superfamily L domain-like 1.31e-34
Family Internalin LRR domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9W2U2
Sequence length 377
Comment (tr|Q9W2U2|Q9W2U2_DROME) RH29237p {ECO:0000313|EMBL:AAM29582.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG32687 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MEVYTSDSSDTDSREQKTLDFGRMSLDLVTLEDHLASPQKALLKSSGDIETMLLNHNRLV
GLPRLLLQFGNLKILDLSSNAITTLPDAVCQLPLVTLIAKNNLLTNASLPKSLLTKMANG
NGNGNATGGTNSTLKELNLSGNQLTHFPEQVTELRHLKYLYLGGNKISSVSKDIWKMQSL
HVLSLGGNLISEVPEAVGSLNQLQALVLCDNLIEILPTSIARLKNLKSLLLHKNRLRHLP
KDIVALKNLTELSLRDNPLVVRFVQDMALKPPTLLELAGRMVKASGQRPGPYDIPRTLAE
YLNSANCCVNPNCKGVFFDNRVEHIKFVDFCGKYRVPLLQYLCSSKCIEPEQPAARGSSV
PAASASSGFMMRKVLLG
Download sequence
Identical sequences Q9W2U2
FBpp0071392 NP_001259412.1.81976 NP_727428.1.81976 7227.FBpp0071392 FBpp0071392 FBpp0071392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]