SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9W3Y6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9W3Y6
Domain Number 1 Region: 252-284,323-426,477-526
Classification Level Classification E-value
Superfamily TPR-like 2.05e-22
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 
Domain Number 2 Region: 65-132,161-200,255-297
Classification Level Classification E-value
Superfamily TPR-like 0.00000348
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9W3Y6
Sequence length 615
Comment (tr|Q9W3Y6|Q9W3Y6_DROME) Anaphase promoting complex subunit 7, isoform A {ECO:0000313|EMBL:AAF46175.2} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG14444 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MASFLIVVEKMEIALFANAKKLYDHKLYECVIPAADLLRTVLKNDRYVATLDVEYQVLLY
LLNANYKERNYRAALRHFDEIIHKRRLMMRHKNAVLVAIESSYPEFGDAEQRRRAAECYR
QIGNTDMAIETLLQVPPTLRSPRINLMLARLQHHGSRHGTTKKSEAVLAYKEVIRECPMA
LQVIEALLELGVNGNEINSLVMHAATVPDHFDWLSKWIKALAQMFNFKHSDASQTFLMLH
DNTTLRCNEHLMMALGKCLYYNGDYFQAEDIFSSTLCANPDNVEAIGLMAVLCGQEGGCE
QDSADMDYLFAKVSSEVKYTASHWFAHAQLLYDEGKFERGLNFVEKCLDSEPRNHEALIL
RGRLLIALERHTQAVCAFRTAQMVAPYRFEIYRGLFHSYLAQKRFKEANALCNWTIRLFQ
NSPRSFTMFGRTLFLFPDPRMRRTARKFAEKSLKINHIYTPAVNLIADICQVEGPTKAII
KLLEKHVIIFPKVNLLNHLGDIMRKQKEPVKAMEYYYKALRQDPKSKRTLRGLRLLAKSD
DESPVLDESDDIGMDNQQSINDLTTLCEATNAQGAEGAESVENSREASSSAAARSGQEED
VDEHDWIDVPDGMSY
Download sequence
Identical sequences Q9W3Y6
FBpp0070907 7227.FBpp0070907 FBpp0070907 NP_572329.3.81976 FBpp0070908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]