SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9W4L5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q9W4L5
Domain Number - Region: 65-154
Classification Level Classification E-value
Superfamily POZ domain 0.00314
Family BTB/POZ domain 0.037
Further Details:      
 
Domain Number - Region: 149-223
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.0273
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9W4L5
Sequence length 553
Comment (tr|Q9W4L5|Q9W4L5_DROME) AT12544p {ECO:0000313|EMBL:AAR27880.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG12692 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MGHIDGTNKLKGFARPAFTSELAFNSVVPWSNEIHRRHGEAIHPCNDAMDFHASVFRSLG
AVTRVCIGTSTFWCTSSLLQFHSNYFDRNICPVNCFREGTDLIAVGFRAAYTWMRLQEPL
DPFMQPDKLMTLLHTAVQLEMPALKALCYEQLCTDRFREETAFQVYLRALKYPQLEELRK
LMLQRIGAAFLAVLGGDDFQRMPLEDVITMLQQDSLGVNSEMEVLVAIIRWLNCQSKCID
QATPLLMDCLRLTLLPLPILKRFWRCAMAPPVPDEPFMNAVRGNIHIRERISCAITVVQM
HHLHTSRREFLDFCRSKGLLVDMPREWIYDEQCHYHLPRPGGPYSHLICVHVISNYAIQR
AQRLMESSKRWPRRVNTYMPPSDDLQTINELPEDKDEEAQVSVEPSAPEMSEGLPQPEED
DCFIARLFRGTLLRLNEVMAAQDRNIERRIDNLIRDGTLRPRFIPNAMSRFVLPTAMTCA
AQEDLQEDLFLQTDFYSSNLDAIDAYFFLHVCRMRQLVQPKVVVPIEKSSEESVRPMESY
VLETDQMIKVLGF
Download sequence
Identical sequences Q9W4L5
FBpp0070626 FBpp0070626 7227.FBpp0070626 FBpp0070626 NP_001284857.1.81976 NP_572159.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]