SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9X956 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9X956
Domain Number 1 Region: 20-285
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.62e-38
Family Haloalkane dehalogenase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9X956
Sequence length 290
Comment (tr|Q9X956|Q9X956_STRCH) Uncharacterized protein orf3 {ECO:0000313|EMBL:CAB43947.1} OX=1902 OS=Streptomyces coelicolor. GN=orf3 OC=Streptomyces; Streptomyces albidoflavus group.
Sequence
MSARGPYDAGRFHDAYDKVMAKWPAGTESVTVPTPFGATHVHLTGPADGRPLVLLPGGGA
ATSACWYAQAAELSRTHRVHAVDLIGAPGRSTPAGDRHPRTVADLAGWLDALLDGLGIAE
TDLGGHSYGAWIALHHTLHAPGRVRRLFLLDPTQCFAGFKAAYLLRALPMLLRPTPRRVR
AFLEWETGATPLDADWVALQEAAVGFPERRPVTGPRPAPEALRALEVPVLLLLAGNSRTH
DAAEVAARARTLLPHVETEALADVSHHALPQSAPPGLGRRLGDFLTAPAG
Download sequence
Identical sequences Q7AKP4 Q9X956
100226.SCO2208 gi|21220680|ref|NP_626459.1| NP_626459.1.49638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]