SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9XVK1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9XVK1
Domain Number 1 Region: 15-102
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.91e-24
Family Nuclear receptor 0.0015
Further Details:      
 
Domain Number 2 Region: 190-355
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.77e-18
Family Nuclear receptor ligand-binding domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9XVK1
Sequence length 356
Comment (tr|Q9XVK1|Q9XVK1_CAEEL) Dauer Pheromone Responsive {ECO:0000313|EMBL:CAB03244.2} KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=CELE_R10D12.2 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MDQSNSDQTNEVARTCLVCTITENVRFHFGSTTCLACASFFRRTVSLKIQYVCKQSNNCI
VSHAVRSGCRSCRFQNCLKSGMKTNMVRGKRDINKVPKYIRESMQQGDNMTVRNYTTSTL
ETLHGFPKQEELELPVVKEDAPNLLIVSPDQLLDYYLDLNEKEPLPLSKIHLNTLGQLNQ
QNHVESEFICKNCPGTDLISTEDKMILIQYVKFANLWLDALWDELHAKDKQDKQNLVHCG
EFADYDRLFSTFISNLYESVGQFLCNLNLDIVEYSALKSFVIWKLGVVDFSITLKIVAQE
HYLGVSAALIEYYKTEKNMEEMEIAVRFADLTLLLGPIFNSYKEMVNLYEEIRTFV
Download sequence
Identical sequences Q9XVK1
R10D12.2 NP_506457.2.50509 6239.R10D12.2 R10D12.2 R10D12.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]