SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9Y2G8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9Y2G8
Domain Number 1 Region: 28-126
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.19e-30
Family Chaperone J-domain 0.0002
Further Details:      
 
Domain Number 2 Region: 146-247
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000608
Family Thioltransferase 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9Y2G8
Sequence length 782
Comment (sp|Q9Y2G8|DJC16_HUMAN) DnaJ homolog subfamily C member 16 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=DNAJC16; OC=Catarrhini; Hominidae; Homo.
Sequence
MEVRKLSISWQFLIVLVLILQILSALDFDPYRVLGVSRTASQADIKKAYKKLAREWHPDK
NKDPGAEDKFIQISKAYEILSNEEKRSNYDQYGDAGENQGYQKQQQQREYRFRHFHENFY
FDESFFHFPFNSERRDSIDEKYLLHFSHYVNEVVPDSFKKPYLIKITSDWCFSCIHIEPV
WKEVIQELEELGVGIGVVHAGYERRLAHHLGAHSTPSILGIINGKISFFHNAVVRENLRQ
FVESLLPGNLVEKVTNKNYVRFLSGWQQENKPHVLLFDQTPIVPLLYKLTAFAYKDYLSF
GYVYVGLRGTEEMTRRYNINIYAPTLLVFKEHINRPADVIQARGMKKQIIDDFITRNKYL
LAARLTSQKLFHELCPVKRSHRQRKYCVVLLTAETTKLSKPFEAFLSFALANTQDTVRFV
HVYSNRQQEFADTLLPDSEAFQGKSAVSILERRNTAGRVVYKTLEDPWIGSESDKFILLG
YLDQLRKDPALLSSEAVLPDLTDELAPVFLLRWFYSASDYISDCWDSIFHNNWREMMPLL
SLIFSALFILFGTVIVQAFSDSNDERESSPPEKEEAQEKTGKTEPSFTKENSSKIPKKGF
VEVTELTDVTYTSNLVRLRPGHMNVVLILSNSTKTSLLQKFALEVYTFTGSSCLHFSFLS
LDKHREWLEYLLEFAQDAAPIPNQYDKHFMERDYTGYVLALNGHKKYFCLFKPQKTVEEE
EAIGSCSDVDSSLYLGESRGKPSCGLGSRPIKGKLSKLSLWMERLLEGSLQRFYIPSWPE
LD
Download sequence
Identical sequences Q9Y2G8
NP_056106.1.87134 NP_056106.1.92137 ENSP00000364998 ENSP00000365007 gi|56687498|ref|NP_056106.1| 9606.ENSP00000365007 ENSP00000365007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]