SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9Y802 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9Y802
Domain Number 1 Region: 257-617,714-758
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.24e-35
Family FAD-linked reductases, N-terminal domain 0.033
Further Details:      
 
Domain Number 2 Region: 153-249
Classification Level Classification E-value
Superfamily Homeodomain-like 3.94e-19
Family SWIRM domain 0.0064
Further Details:      
 
Domain Number 3 Region: 598-698
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.0000000000000654
Family L-aminoacid/polyamine oxidase 0.0027
Further Details:      
 
Domain Number 4 Region: 839-928
Classification Level Classification E-value
Superfamily HMG-box 0.0000000353
Family HMG-box 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9Y802
Sequence length 1000
Comment (sp|Q9Y802|LSD1_SCHPO) Lysine-specific histone demethylase 1 KW=Complete proteome; Reference proteome OX=284812 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). GN=lsd1; OC=Schizosaccharomycetaceae; Schizosaccharomyces.
Sequence
MMDLSSKDALSDVLKDTHAQSSDPSLWAIFGHQSSDNVHEGGNESVSVEQEIFDLSQLSE
RPVSETVSKASIPTNINGLSQVKPSALEKSQEVLSLQKLPIKGRRPAGRRGRPALNTSNS
LERNGTRYVSAEAPISVKSSIPAIPRVTFERLCYESAIASNLPPNALSPLEAEMLSEILE
NPTWLSLYLSIRNGICYLWHRNPTLYVSFNEALGIVREKKAFPLASLAFEFLSRNGHINY
GCIYIISSLKLDESLSQKTVAIIGAGMAGISCARQLTNLFAQYEQDFLSRGEKPPRIVIY
EASERLGGHIYTHMVPLSDNEVSEKSSLATTVNATNECMVNLLTDSLIGMPTLDSDPLYI
ISSQQLSLDAVHTRNREFILHDIENGRIDTEHVQRIFRLFDALLFYFNASASKQPLHSLI
TPPEQEFIQKLDQIGWYISIEAFPLQIKDTLSEFLGNSANTLTSLLHLTVLDLKIFEWFK
EYLSQSLSVSLENVYPGSIPNLNLLLGENVASYSFKHGMADMLNSLASTPSPLPILFDQC
VHTVKLEDNTVNLSFVNETTVSVDKVVICIPMDKLNTHLITFEPPLEEKKLKAIDRCHFT
NVKKVILIFKTQFWEPNISIFGSLPQDSGRNFIFNDCTRFYEHPTLSVFVKVEGIDFMKD
DDIVNGIVSQLKKVYKPKSEAINPIRTIISNWENNSYTNHSSYQISNLFLEEDYAILSEP
IDNTVFFASEAISQKNSGSIRGAFDSGILAARDVLASLIGNVVLPNTLVIEENLEQPRKT
YGTKRNAQQALGKEGERENKEKRISYHTEYLRLRQKRLDKEQQECDLLIAELLGPSPVPP
SRPSANPYLLYQKTQWHVCKTLADQDKQRVTGDPEARATKNEIRAKLGKTWRALDSLGKQ
PWVDEINARRANYSTRLEEYQRQINSYNVRVAQIKSEHQRRCESQPIPEDEAKLKLLAEQ
EDEHLHPEKEGMSVENSDDDYHDDLDYEDSISEVFPDNFS
Download sequence
Identical sequences Q9Y802
SPBC146_09c.1 4896.SPBC146.09c-1 NP_595398.1.19918 SPBC146.09c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]