SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9YBY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9YBY3
Domain Number 1 Region: 14-164,265-348
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.83e-36
Family Bacterial dinuclear zinc exopeptidases 0.0053
Further Details:      
 
Domain Number 2 Region: 165-234
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.000000000144
Family Bacterial exopeptidase dimerisation domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9YBY3
Sequence length 350
Comment (sp|Q9YBY3|LYSK_AERPE) Putative [LysW]-lysine/[LysW]-ornithine hydrolase {ECO:0000255|HAMAP-Rule:MF_01120} KW=Complete proteome; Reference proteome OX=272557 OS=100138 / K1). GN=APE_1467.1; OC=Desulfurococcaceae; Aeropyrum.
Sequence
MVSSDAYVEGLAAKLALDLLRVYTPTGSEERLYPVLERWASELGLGFSLDSAGNAVLSAG
PDGLPVVGLVGHLDTVPGRLEARLEGYTLWGRGAVDAKGPLAAMILGLHLASSEGLSCSS
AVLGLVGEEGDSPGAWSLVSRGDTPLHIIVGEPTGGDGVAIGYRGSLTIEIECTGHEGHS
SNPERGAADMLVKALASILERDSRATVTRLKAGTAANITPGRALATVNMRFNEPGLEALQ
LASELCSSLHQHRCHCSSISLLHPVKTSLSNATARALVASLRTAGVKPRIVVKRGTSDMN
VLSIATESIAAYGPGDPRLSHTKHENIRVGDIVKAAMIYSRTLTILCNSL
Download sequence
Identical sequences Q9YBY3
272557.APE_1467.1 gi|77640972|ref|NP_147963.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]