SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9YET9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9YET9
Domain Number 1 Region: 13-198
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 4.6e-30
Family NADH oxidase/flavin reductase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9YET9
Sequence length 201
Comment (tr|Q9YET9|Q9YET9_AERPE) Uncharacterized protein {ECO:0000313|EMBL:BAA79457.2} KW=Complete proteome; Reference proteome OX=272557 OS=100138 / K1). GN=APE_0492.1 OC=Desulfurococcaceae; Aeropyrum.
Sequence
MGLPEPTKVSGVDVLEAIRRRRSRRSFSRRPLTLTEVSTILFHVAGITGLAWWGGPKRPY
PSAGALQPVEAYLVVERVEGLKPGLYHYNPSGHCLEMLREGKLLGRLADVSLGQDHVAEA
AAALVLTAVYTRTGSKYGHRSYRYVHWDTGFAGENVYLVCEALGLATVAVGAFYDDEMCG
FLEIDCPWEMPMLVFPVGARG
Download sequence
Identical sequences Q9YET9
gi|118431077|ref|NP_147276.2| 272557.APE_0492.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]