SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9Z0M0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9Z0M0
Domain Number 1 Region: 219-284
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.42e-17
Family Complement control module/SCR domain 0.00014
Further Details:      
 
Domain Number 2 Region: 162-234
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.53e-16
Family Complement control module/SCR domain 0.00024
Further Details:      
 
Domain Number 3 Region: 36-101
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000027
Family Complement control module/SCR domain 0.00039
Further Details:      
 
Domain Number 4 Region: 97-172
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000144
Family Complement control module/SCR domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9Z0M0
Sequence length 399
Comment (tr|Q9Z0M0|Q9Z0M0_RAT) Decay accelerating factor GPI-form {ECO:0000313|EMBL:AAC77438.1} OX=10116 OS=Rattus norvegicus (Rat). GN=rCG_46364 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MIRTRAPGTRAPPPPPLLLSLSLLLLLLSPTVSGDCGPPPDIPNATPNSGKHTKFAHQSQ
VTYSCNKGFKQIPDKPNTVVCLENDQWSNYETFCNKTCSAPLRLNYASLKKEYRNMNFFP
IGTTVEFECRPGFQKVTSRTGKSTCLEELVWSPVVEFCKKRACPNPRELKNGHINIPTDI
LFGSEIIFSCDKGYKLVGVTSTFCSITGNAVDWDDVFPVCTTIFCPDPPKINNGRIREES
DSYAYRQSVTYSCDQGFILVGNSSVHCTLNGEVGEWSSAPPKCIERHKVPTKTPPEVDIP
STMPHESTLINFPSTRAPLSHKPTTVKVPGTRVKPTSHKPTEVKVPATQHVPVSKTTVRH
PTRTSKDRGESNSGGDHFIYGHTCLITMTILHVMLLLTG
Download sequence
Identical sequences Q9Z0M0
NP_071605.2.100692 NP_071605.2.4139 ENSRNOP00000005284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]