SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9Z0M4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9Z0M4
Domain Number 1 Region: 105-180
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.78e-16
Family Complement control module/SCR domain 0.00063
Further Details:      
 
Domain Number 2 Region: 232-294
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000134
Family Complement control module/SCR domain 0.00092
Further Details:      
 
Domain Number 3 Region: 164-234
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000032
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 4 Region: 43-110
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000017
Family Complement control module/SCR domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9Z0M4
Sequence length 355
Comment (sp|Q9Z0M4|MCP_RAT) Membrane cofactor protein KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Cd46; OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MTAAPLTPDPTHPRRRRKSYTFFSLGIYAEALLFLLSSLSDACEPPPPFEAMELKDKPKP
HYAIGEIIEYTCKKGYLYLSPYPMTAICQPNHTWVPISDHGCIKVQCTMLQDPSFGKVHY
IDGRFSWGARVKYTCMNGYYMVGMSVLQCELNGNGDAFWNGHPPSCKKVYCLPPPKIKNG
THTFTDIKVFKYHEAVIYSCDPNPGPDKFSLVGPSMLFCAGHNTWSSDPPECKVVKCPFP
VLQNGRQISRTEKKFSYQALVLFQCLEGFYMEGSSMVVCGAKSSWEPSIPQCLKGPKPHS
TKPPVYSESGYPSPREGIFGQEFDAWIIALIVVTSVVGVIVICLIILRCSEYRKK
Download sequence
Identical sequences Q9Z0M4
ENSRNOP00000053980 NP_062063.1.100692 NP_062063.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]