SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9Z2C5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9Z2C5
Domain Number 1 Region: 159-543
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.44e-158
Family Myotubularin-like phosphatases 0.00000000003
Further Details:      
 
Domain Number 2 Region: 35-155
Classification Level Classification E-value
Superfamily PH domain-like 5.1e-42
Family GRAM domain 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9Z2C5
Sequence length 603
Comment (sp|Q9Z2C5|MTM1_MOUSE) Phosphatidylinositol-3-phosphate phosphatase KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Mtm1; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MASASASKYNSHSLENESIKKVSQDGVSQDVSETVPRLPGELLITEKEVIYICPFNGPIK
GRVYITNYRLYLRSLETDSALILDVPLGVISRIEKMGGATSRGENSYGLDITCKDLRNLR
FALKQEGHSRRDMFEILVKHAFPLAHNLPLFAFVNEEKFNVDGWTVYNPVEEYRRQGLPN
HHWRISFINKCYELCETYPALLVVPYRTSDDDLRRIATFRSRNRLPVLSWIHPENKMVIM
RCSQPLVGMSGKRNKDDEKYLDVIRETNKQTSKLMIYDARPSVNAVANKATGGGYESDDA
YQNSELSFLDIHNIHVMRESLKKVKDIVYPNIEESHWLSSLESTHWLEHIKLVLTGAIQV
ADQVSSGKSSVLVHCSDGWDRTAQLTSLAMLMLDSFYRTIEGFEILVQKEWISFGHKFAS
RIGHGDKNHADADRSPIFLQFIDCVWQMSKQFPTAFEFNEGFLITVLDHLYSCRFGTFLF
NCDSARERQKLTERTVSLWSLINSNKDKFKNPFYTKEINRVLYPVASMRHLELWVNYYIR
WNPRVKQQQPNPVEQRYMELLALRDDYIKRLEELQLANSAKLADAPASTSSSSQMVPHVQ
THF
Download sequence
Identical sequences Q9Z2C5
NP_001157662.1.92730 NP_001157663.1.92730 NP_064310.2.92730 ENSMUSP00000057182 ENSMUSP00000033700 ENSMUSP00000057182 ENSMUSP00000110264 ENSMUSP00000125798 10090.ENSMUSP00000099041 ENSMUSP00000033700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]