SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R0GAY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R0GAY3
Domain Number 1 Region: 66-237
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.13e-63
Family Inorganic pyrophosphatase 0.0000036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R0GAY3
Sequence length 238
Comment (tr|R0GAY3|R0GAY3_9BRAS) Uncharacterized protein {ECO:0000313|EMBL:EOA13774.1} KW=Complete proteome; Reference proteome OX=81985 OS=Capsella rubella. GN=CARUB_v10026867mg OC=Capsella.
Sequence
MAATLLTTAAAVASSQTTSGLLTKRPVFLPARTVCRFNGLCFNKRSLVVKSKRPFSCNAI
YNPQVQTIQEGQSESLDYRVFFQDGSGKKVSPWHDIPLHLGDGVFHFIVEIPKESRAKME
VATDEAFTPIKQDTKKGKLRYYPYNINWNYGLLPQTWEDPTQANSEVEGAFGDNDPVDVV
EIGETRRKTGEVLKVKPLAALAMIDEGELDWKIVAISLDDPKAHLVNDVDDVEKHFPV
Download sequence
Identical sequences R0GAY3
Carubv10027035m|PACid:20911365 XP_006280876.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]