SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R0I4Z0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R0I4Z0
Domain Number 1 Region: 31-213
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.44e-66
Family Inorganic pyrophosphatase 0.00000544
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R0I4Z0
Sequence length 218
Comment (tr|R0I4Z0|R0I4Z0_9BRAS) Uncharacterized protein {ECO:0000313|EMBL:EOA31418.1} KW=Complete proteome; Reference proteome OX=81985 OS=Capsella rubella. GN=CARUB_v10014598mg OC=Capsella.
Sequence
MADNKDEGSAKGYAFPLKNPNVTLNERNFAAFTHRQAAAHPWHDLEIGPEAPTVFNCVVE
ISKGGKVKYELDKNSGLIKVDRVLYSSIVYPHNYGFIPRTICEDSDPIDVLVLMQEPVLT
GSFLRARAIGLMPMIDQGEKDDKIIAVCADDPEFRHYRELNELPPHRLAEIRRFFEDYKK
NENKKVDVEAFLPAQAAIDAIKDSMDLYAAYIKAGLQR
Download sequence
Identical sequences R0I4Z0
XP_006298520.1.15642 Carubv10014598m|PACid:20899495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]