SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R0IAW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R0IAW2
Domain Number 1 Region: 18-212
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.36e-43
Family PAPS reductase-like 0.0042
Further Details:      
 
Domain Number 2 Region: 273-383
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.02e-22
Family PDI-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R0IAW2
Sequence length 386
Comment (tr|R0IAW2|R0IAW2_9BRAS) Uncharacterized protein {ECO:0000313|EMBL:EOA35280.1} KW=Complete proteome; Reference proteome OX=81985 OS=Capsella rubella. GN=CARUB_v10020447mg OC=Capsella.
Sequence
MNFVTEVEEKGGEVEDFEQLAKKLEDASPLEIMDKALEKFGDDIAIAFSGAEDVALIEYA
RLTGKPFRVFSLDTGRLNPETYRLFDAVEKQYGIRIEYMFPDAVEVQALVRNKGLFSFYE
DGHQECCRVRKVRPLRRALKGLKAWITGQRKDQSPGTRSEIPIVQVDPVFEGLDGGAGSL
VKWNPLANVEGADVWTFLRTMDVPVNALHAQGYVSIGCEPCTRPVLPGQHEREGRWWWED
AKAKECGLHKGNIKEEDGAVDSKPAAVQEIFESNNVVTLSKEGIENLTKLRNRKEAWLVV
LYAPWCPFCQAMEASYIELAEKLAGKGVKVAKFRADGEQKEFAKQELQLGSFPTILLFPK
SAPRAIKYPSEHRDVDSLMSFVNLLR
Download sequence
Identical sequences R0IAW2
Carubv10020447m|PACid:20907098 XP_006302382.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]