SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R0IDH7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R0IDH7
Domain Number 1 Region: 1-150
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.79e-27
Family N-acetyl transferase, NAT 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R0IDH7
Sequence length 174
Comment (tr|R0IDH7|R0IDH7_9BRAS) Uncharacterized protein {ECO:0000313|EMBL:EOA36260.1} KW=Complete proteome; Reference proteome OX=81985 OS=Capsella rubella. GN=CARUB_v10010452mg OC=Capsella.
Sequence
MTTIRRFSCNDLLRFTSVNLDHLTETFNMSFYMTYLARWPDYFHVAEGPGNRVMGYIMGK
VEGQGESWHGHVTAVTVSPEYRRQQLAKKLMNLLEDISDKIDKAYFVDLFVRASNTPAIK
MYEKLGYIIYRRVLRYYSGEEDGLDMRKALSRDVEKKSVIPLKRPITPDELEYD
Download sequence
Identical sequences A0A087HKM3 A0A178WDM9 D7KCB9 Q8LGI8 R0IDH7
GO.132 AT1G03150.1 3702.AT1G03150.1-P 59689.scaffold_100261.1 NP_563677.1.80155 XP_002889439.1.15461 XP_006303362.1.15642 XP_010474913.1.75697 XP_010474924.1.75697 Carubv10010452m|PACid:20891198 jgi|Araly1|887467|scaffold_100261.1 AT1G03150.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]