SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R0JUK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R0JUK0
Domain Number 1 Region: 603-645
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000377
Family EGF-type module 0.005
Further Details:      
 
Domain Number 2 Region: 412-541
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000111
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 705-831
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000596
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number 4 Region: 637-678
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000305
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 5 Region: 348-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000349
Family EGF-type module 0.007
Further Details:      
 
Domain Number 6 Region: 312-352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000684
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 7 Region: 271-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000113
Family EGF-type module 0.011
Further Details:      
 
Domain Number 8 Region: 682-716
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000117
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  R0JUK0
Domain Number - Region: 567-603
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000382
Family EGF-type module 0.067
Further Details:      
 
Domain Number - Region: 238-277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0189
Family EGF-type module 0.05
Further Details:      
 
Domain Number - Region: 388-418
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0455
Family EGF-type module 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R0JUK0
Sequence length 1193
Comment (tr|R0JUK0|R0JUK0_ANAPL) Delta-like protein {ECO:0000256|RuleBase:RU280815} OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=Anapl_02314 OC=Anatinae; Anas.
Sequence
QVTLASGQFELEILSMQNVNGELQNGNCCDGTRNPGDRKCTRDECDTYFKVCLKEYQSRV
TAGGPCSFGSKSTPVIGGNTFNLKYSRNNEKNRIVIPFSFAWPRSYTLLVEAWDYNDNST
NPDRIIEKASHSGMINPSRQWQTLKHNAGVAHFEYQIRVTCTEHYYGFGCNKFCRPRDDF
FTHHTCDQNGNKTCLEGWMGPECNKAICRQGCSPKHGSCTIPGECRCQYGWQGQYCDKCI
PHPGCVHGTCIEPWQCLCETNWGGQLCDKDLNYCGTHPPCLNGGTCSNTGPDKYQCSCPE
GYSGQNCEIAEHACLSDPCHNGGSCLETSTGFECVCAPGWAGPTCTDNIDDCSPNPCGHG
GTCQDLVDGFKCICPPQWTGKTCQLDANECEGKPCVNANSCRNLIGSYYCDCITGWSGHN
CDININDCRGQCQNGGSCRDLVNGYRCICSPGYAGDHCEKDINECASNPCMNGGHCQDEI
NGFQCLCPAGFSGNLCQLDIDYCEPNPCQNGAQCFNLAMDYFCNCPEDYEGKNCSHLKDH
CRTTPCEVIDSCTVAVASNSTPEGVRYISSNVCGPHGKCKSQAGGKFTCECNKGFTGTYC
HENINDCESNPCKNGGTCIDGINSYKCICSDGWEGTYCETNINDCSKNPCHNGGTCRDLV
NDFFCECKNGWKGKTCHSRDSQCDEATCNNGGTCYDEGDTFKCMCPAGWEGATCNIARNS
SCLPNPCHNGGTCVVSGDSFTCVCKEGWEGPTCTQNTNDCSPHPCYNSGTCVDGDNWYRC
ECAPGFAGPDCRININECQSSPCAFGATCIDEINGYRCICPPGRSGPGCQEVTGRPCITT
VRVMPDGAKWDDDCNTCQCLNGKVTCSKVWCGPRPCVIHAKGHNECPSGHACVPVKEDHC
FTHPCAAVGECWPSNQQPVKTKCNPDSYYQDNCANITFTFNKEMMAPGLTTEHICSELRN
LNILKNVSVEYSIYITCEPSHLANNEIHVAIAAEDIGEDENPIKEITDKIIDLVSKRDGN
NTLIAAVAEVRVQRRPVKNKTDFLVPLLSSVLTVAWICCLVTVFYWCIRKRRKQSSHTHT
ASDDNTTNNVREQLNQIKNPIEKHGANTVPIKDYENKNSKIAKIRTHNSEVEEDDMDKHQ
QKARFAKQPAYTLVDRDEKPPNSTPTKHPNWTNKQDNRDLESAQSLNRMEYIV
Download sequence
Identical sequences R0JUK0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]