SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R0K771 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R0K771
Domain Number 1 Region: 180-409
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.75e-57
Family Voltage-gated potassium channels 0.00074
Further Details:      
 
Domain Number 2 Region: 39-144
Classification Level Classification E-value
Superfamily POZ domain 2.75e-32
Family Tetramerization domain of potassium channels 0.00000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R0K771
Sequence length 658
Comment (tr|R0K771|R0K771_ANAPL) Potassium voltage-gated channel subfamily D member 3 {ECO:0000313|EMBL:EOB05637.1, ECO:0000313|Ensembl:ENSAPLP00000013835} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=Anapl_02050 OC=Anatinae; Anas.
Sequence
MAAGVAAWLPFARAAAIGWMPVANCPMPLAPTEKNKRQDELIILNVSGRRFQTWRTTLER
YPDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCILNFYRTGKLHYPRYECISAYDEELAF
YGILPEIIGDCCYEEYKDRKRENAERLMDDNDSENNQEGSMPSLSFRQTMWRAFENPHTS
TLALVFYYVTGFFIAVSVITNVVETVPCGTVPGNKELPCGERYAVAFFCLDTACVMIFTV
EYLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMTNNEDVSGAFVTLRVFRVFRIFK
FSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPASFW
YTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRADKR
RAQKKARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGSTEDEQHMTKGTSLIESQHHH
LLHCLEKTTGLSYLVDDPLLSVRTSTIKNHEFIDEQLFEQNCMESSMQNYPSSRSPSLSS
HHGLTTSCCSRRNKKTTHLPNSSVPATRLRSMQELSTIHIQCSEQPSLTTSRSSLNMKSD
DGLRPNCKAAQITTAIISIPTPPALTPEGESRPPPSSPGHSTNISTTTTSNIVKVSAL
Download sequence
Identical sequences R0K771
ENSAPLP00000013835 XP_005013735.1.99704 XP_013045158.1.65836 XP_013045159.1.65836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]