SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R0LMZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R0LMZ6
Domain Number 1 Region: 14-268
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.03e-67
Family Ankyrin repeat 0.0000507
Further Details:      
 
Domain Number 2 Region: 246-364
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000122
Family Ankyrin repeat 0.0099
Further Details:      
 
Domain Number 3 Region: 455-501
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000392
Family SOCS box-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R0LMZ6
Sequence length 538
Comment (tr|R0LMZ6|R0LMZ6_ANAPL) Ankyrin repeat and SOCS box protein 3 {ECO:0000313|EMBL:EOB01783.1} OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=Anapl_01557 OC=Anatinae; Anas.
Sequence
MDFTEAYSDRCSTVGLAAREGNVKMLRKLIKQGYSLDVPDNRGWMPIHEAAAHSASECLR
LLIDAAPSDNYINSKTFEGMGALHLSARCGSLENVGVLLEAGVNADEVTTEATTALFLAV
ENGHVEVVKLLLQHGANVEGPHSWSGWNSLHQAAFQGYTEIIKILLEKGASIECKDDFGI
TPLFVAAQYGKLESLRVLVSHGADINCQAKDRATPLLIAAQEGHAKCVELLLSKGADPNL
YCNEDNWQLPIHAAAEMGHKNILEMLIPITDRICDREKGKVSPVYSAVYGGNKECLEMLL
KEGYSPDAQECLSFDCRSPMCMVFQKKFFNLIGIFLKYGITLLGINLGYCLCHEKFTLFR
RFLKLGCSLPSGDQLSEFISYTVKAHEDYKEWLPHLLLAGFNPVNLLFRFWIYSVSEDVL
NFILEFTNWKRLPPAVERDLSDYKEKFSWTPKSHFAFIPSLSHLCRLEIRSILTSERLRS
DRFIRDLPLPACLQDYLLYLDVLRASAVPEQEDCLGQREEAVHSATTSSSEDAERRDS
Download sequence
Identical sequences R0LMZ6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]