SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R4GAC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R4GAC2
Domain Number 1 Region: 42-125
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 8.7e-27
Family SCAN domain 0.00027
Further Details:      
 
Domain Number 2 Region: 362-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.5e-22
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 502-558
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.63e-22
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 446-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.56e-21
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 543-595
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.34e-20
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 6 Region: 323-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.75e-17
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 7 Region: 191-243
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000209
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 
Domain Number 8 Region: 408-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000129
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R4GAC2
Sequence length 607
Comment (tr|R4GAC2|R4GAC2_ANOCA) Uncharacterized protein {ECO:0000313|Ensembl:ENSACAP00000022216} KW=Complete proteome; Reference proteome OX=28377 OS=Anolis carolinensis (Green anole) (American chameleon). GN=LOC100560742 OC=Toxicofera; Iguania; Dactyloidae; Anolis.
Sequence
MDRPDSAGPEAGNVLEGLSAGNKGRFWARPMLKFLGDNFANSDTQPHHFGQFSCEEVEWP
REICSQLHHLCRQWLKPEKHTKNQMLDLVVLEQFLTLLPSKMSSWVRECGAETCSQAVAL
AEGFLLSKEAEEQDEEQQAKKLSTDIQPDFSAVREAPSDARQNSQQRDITLQGAEAIQGT
MALGYNGAGLFQVPVTFEEVAVSFLPEEWGFLNADQRALYNEVMEETCSIMSALGNWKGK
NAFANHRNPHTQIFPKHEEACIEEKCPEEMSCICTNCGRCFTPNTIHVCDERMQQEENHF
GYEILVKGVDCKLQHERYHIAEKAHKCQECGKCFASKSHLRQHQAIHTGDKPYSCQECGK
CFISTSGLLRHLRTHTGEKPYRCQMCGKCFVSNSVLLIHQRIHTGEKPYKCQECGKCYAH
HSGLVVHQGMHTGEKPHNCQECGKCFHSRSGLLKHQRIHTGEKPYKCQECEKCFLSKSSF
VDHKRVHTGEKPFKCQECGKCYARNSVLIIHLRTHTGEKPYGCQECGKCFNSKPELLNHQ
RIHTGEKPYKCQECGKCYARKPDLVIHQRTHTGEKPYSCEECGKRFSSKSCLVIHQKIHQ
KYSTYST
Download sequence
Identical sequences R4GAC2
ENSACAP00000022216 XP_008119839.1.98722 XP_008119840.1.98722 XP_016853277.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]