SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R4GAK1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R4GAK1
Domain Number 1 Region: 61-142
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.1e-24
Family SCAN domain 0.00032
Further Details:      
 
Domain Number 2 Region: 698-754
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.4e-21
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 417-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.66e-20
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 4 Region: 754-810
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.64e-18
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 5 Region: 530-586
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.06e-18
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 6 Region: 642-698
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-17
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 7 Region: 474-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-17
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 217-262
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.76e-16
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 9 Region: 585-642
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000126
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 10 Region: 379-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000436
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 11 Region: 799-839
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000818
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R4GAK1
Sequence length 854
Comment (tr|R4GAK1|R4GAK1_ANOCA) Uncharacterized protein {ECO:0000313|Ensembl:ENSACAP00000022300} KW=Complete proteome; Reference proteome OX=28377 OS=Anolis carolinensis (Green anole) (American chameleon). GN=LOC100562781 OC=Toxicofera; Iguania; Dactyloidae; Anolis.
Sequence
MEKGRGSSVLMEPRVKLEESNQTSPEGGREPNEMWDRRTVGSPGRMGQDALEEKAFRANL
RYQRFQGFHFQETLGPREVCSRLHSLCRLWLKPEKHSKAEMVDLVLLEQFLAVLPAEMER
WVRECGAETSSQAVALAEGFLLSRAEEEKALQEEQKEREDLQAQEAPLETSKTFPSRWIK
LEEEEEDTRAAPPEEEPRMLGSHNGLSVCEAGETASMEQDQVTFEDVFVHFSEEEWALLD
PDQQALHWEIMGENYKMLASFGGAGKESENGTASYKVWFKPAEYIEGEEGNLETEREDYR
RKECSASMRENTVQETVDESREIRNCLVLETNFLHEDSCLNGDSTIRIEKGQPQCHQQEE
SFGSSIHLRNYEKPQIVAKLYKCLECGKGFSEKRSLIGHEMNHRGEKPYMCLECGKSFSL
RERLKLHQNTHRGEKPFKCLECGKCFFQKGNLNKHKRTHTGEKLYKCQECGKDFSERRSL
IGHEMNHRGEKPYKCTKCGKCFHLKGVLNKHQKTHTGENIYKCLECGKGFSEKRSLIGHE
INHRGEKPYKCLECGKSFCWKRSLKLHHYTHMGEKPYKCLTCGKSFVENRNLTRHEMTHR
GGMPYKCLECGKCFHHEGVLNTHQKTHMEEKPYKCLRCGKHFFHKGNHKRHERTHTGEKP
YKCLECAKGFSDKRSLITHEMNHRGEKPYKCLECAKGFSHKQSLIAHEMNHRGEKPYKCP
ECGKGFSDKRSLIGHERNHRGEKPYKCPECGKGFSGKRSLIGHEMKHRGEKPYKCLECGK
GFSHKRSLIAHEMNHRGEKPYKCLECGKSYSLKSILTTHQNSHTRECGKRFGFKSDLKNV
QNTLIEEKSKTSLD
Download sequence
Identical sequences R4GAK1
ENSACAP00000022300 XP_003228799.2.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]