SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R4GCT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R4GCT8
Domain Number 1 Region: 20-181,211-273
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.93e-68
Family BAR domain 0.00037
Further Details:      
 
Domain Number 2 Region: 266-297,332-389
Classification Level Classification E-value
Superfamily SH3-domain 9.03e-17
Family SH3-domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R4GCT8
Sequence length 390
Comment (tr|R4GCT8|R4GCT8_ANOCA) SH3 domain containing GRB2 like, endophilin B1 {ECO:0000313|Ensembl:ENSACAP00000023161} KW=Complete proteome; Reference proteome OX=28377 OS=Anolis carolinensis (Green anole) (American chameleon). GN=SH3GLB1 OC=Toxicofera; Iguania; Dactyloidae; Anolis.
Sequence
MNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKLWTEKVM
KQTEVLLQPNPNARMEEFVYEKLDRKAPSRVNNPELLGQHMIDAGNEFGPGTAYGNALIK
CGETQKRIGAADRELIQTAAINFLTPLRNFIEGDYKTITRERKLLQNKRLDLDAAKTRLR
KAKVAEARAAQLNLSPPEENNVMVWAEEVTKSEQEVRIAQSEFDRQAEITRLLLEGISST
HAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLGSFPSTFLANNNQSTTTCVPSSSNTTT
AASSVSVTASLSSLSNVAAPSSFGELKSSSGSRKARVLYDYDAANSTELSLLADEVITVY
SIPGMDSDWLMGERGNQKGKVPITYLELLN
Download sequence
Identical sequences R4GCT8
ENSACAP00000023161 XP_003220159.2.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]