SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R4NHQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R4NHQ7
Domain Number 1 Region: 53-205
Classification Level Classification E-value
Superfamily Virus ectodomain 4.67e-44
Family Virus ectodomain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R4NHQ7
Sequence length 270
Comment (tr|R4NHQ7|R4NHQ7_9MONO) Fusion glycoprotein F0 {ECO:0000256|SAAS:SAAS00628579} OX=162145 OS=Human metapneumovirus. GN=F OC=Mononegavirales; Pneumoviridae; Metapneumovirus.
Sequence
MSWKVVIIISLLITPQHGLKESYLEESCSTITEGYLSVLRTGWYTNVFTLEVGDVENLTC
SDGPSLIKTELDLTKSALRELKTVSADQLAREEQIENPRQSRFVLGAIALGVATAAAVTA
GVAIAKTIRLEGEVTAIKNALKTTNEAISTLGNGVRVLATAVRELKDFVSKNLTRAINKN
KCDIDDLKMAVSFSQFNRRFLNVVRQFSDNAGITPAISLDLMTDAELARAVSNMPTSAGQ
IKLMLENRAMVRRKGFGILIGVYGSSVIYM
Download sequence
Identical sequences R4NHQ7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]