SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R4VSF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R4VSF2
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily Vng1086c-like 1.44e-29
Family Vng1086c-like 0.0000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R4VSF2
Sequence length 92
Comment (tr|R4VSF2|R4VSF2_9EURY) Uncharacterized protein {ECO:0000313|EMBL:AGN00140.1} KW=Complete proteome; Reference proteome OX=1333523 OS=Salinarchaeum sp. Harcht-Bsk1. GN=L593_00925 OC=Salinarchaeum.
Sequence
MHKDELLELHEQMVTIMRHFRDREDSDPALFEPYEQLDIEPDHVHKSKNEHKHAVFVLGN
ALASAMSEDEFSSAGRIGKRMEELADDAEQKI
Download sequence
Identical sequences R4VSF2
gi|510880270|ref|YP_008052938.1| WP_020445034.1.31664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]