SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R7KGD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R7KGD5
Domain Number 1 Region: 27-265
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.34e-56
Family Glycosyl hydrolases family 16 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R7KGD5
Sequence length 268
Comment (tr|R7KGD5|R7KGD5_9BACE) Beta-glucanase {ECO:0000313|EMBL:CDE75430.1} KW=Complete proteome OX=1263054 OS=Bacteroides thetaiotaomicron CAG:40. GN=BN644_01603 OC=Bacteroides; environmental samples.
Sequence
MKQFRNLLFISTLLLCWVLVSCKTTRVSSSGWSLVWEENFNQKKGFDPQVWSKIPRGKAD
WNNYMTDFDSCFAMRKGKLVLRGIANQTLPNDTAPYLTGGVYTKGKKAFLDGRIEICAKL
NAAKGAWPAIWLLPENAKWPSGGEIDVMERLNDDSIAYQTVHSHYTYTLGIKEHPKSHFT
GVIHPDRYNVFAVEMYPDSLSFYVNDIHTFTYPRIQTQKEGQFPFDQPFYLLIDMQLGGS
WVGVVDPKDLPVEMEVDWVRFYQRKSLK
Download sequence
Identical sequences A0A1H6CLF8 Q8A4P7 R7KGD5
226186.BT_2550 gi|29347960|ref|NP_811463.1| NP_811463.1.73244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]