SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R7Q9L5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R7Q9L5
Domain Number 1 Region: 62-245
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.21e-39
Family PAPS reductase-like 0.0021
Further Details:      
 
Domain Number 2 Region: 302-395
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.46e-23
Family Thioltransferase 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R7Q9L5
Sequence length 401
Comment (tr|R7Q9L5|R7Q9L5_CHOCR) 5'-adenylylsulfate reductase (Glutathione), APR, Rhodoplastic {ECO:0000313|EMBL:CDF34066.1} OX=2769 OS=Chondrus crispus (Carrageen Irish moss) (Polymorpha crispa). GN=CHC_T00009224001 OC=Gigartinales; Gigartinaceae; Chondrus.
Sequence
MFAFTMPAAPLALRASSFTAAAATPRRRHVRAARLPPRAVLSPVDFDSLGAEWAALPPKD
KKSPTEIVDHALENFPGTVAIAFSGAEDVVLIEYASRTEKPFRVFALDTGRLHPETYRFY
REVEKHYGIKIEYTFPESAEVTELVNEKGMFSFYEDGHQECCRVRKVRPLRRKLATLSAW
ITGQRKDQSPGTRAEIPIIQTDPAFKGTNDSVLIKYNPLANVSSSEVWATIRATEVPYNA
LHAQGFTSIGCEPCTRPVLPNQHEREGRWWWEEATQKECGLHKGNISTEAGAEEAADAFA
IENIAGDKVVVFTKKGCKYCAALKDLFKDIGVHYSEHEISEMANYGDIVAALERLTGQTT
APNLFVGGKHIGGNQETQTMHADGKLVPLLESVGAQISVSA
Download sequence
Identical sequences R7Q9L5
XP_005713885.1.52529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]