SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R7T0R7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R7T0R7
Domain Number 1 Region: 419-500,537-548
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000372
Family UBX domain 0.048
Further Details:      
 
Domain Number 2 Region: 215-302
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000671
Family Thioltransferase 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R7T0R7
Sequence length 601
Comment (tr|R7T0R7|R7T0R7_DICSQ) Uncharacterized protein {ECO:0000313|EMBL:EJF61570.1} KW=Complete proteome; Reference proteome OX=732165 OS=Dichomitus squalens (strain LYAD-421) (Western red white-rot fungus). GN=DICSQDRAFT_169986 OC=Agaricomycetes; Polyporales; Polyporaceae; Dichomitus.
Sequence
MDIDSLSPAQTNGGDAEVAISVLASVDWDVQRAAEVVFDGVPPPPSPPAHESTNHVEQFE
IDDSEQDGLLNGPQGRREFRPVESSFFGTIIIRPLRIVFNILAIPLYPLFSLLRFIFRAL
RIPLPSFGSYSFSYRPLGPGRSRESRDPKSVAEQWVRALEEETGAVCISRSGNRKQSQGN
GHGVASGVAGPSTLTARGSAWEEGSNGSAESDKLLPDFFLGGYEEFARTCQRDLKIGCVV
IVSSEHDNDAEFKRSTLTDPSFLRIIQENEILVWGGDIRDREAWSAAQKLQATTYPFIAF
IALQPRRAPGSSSAPAPTMTILSRHQGPSIPSTSAPTAAQTLVIHLNEQLLPRVTPFLNK
LRLEAAERERERALRAEQDRAFEESRRKDAERILQKRAADAAAQDEKRRAAEAQARAIEE
EHKAEEAKKQWVAHRMEWRRWLRRGLVLREPRPGESGRGKTMRVGVRMPDGRRSVRFFGE
SDPLTSLYAYVDSLLIPPEFVQDADPVAPPQGGKEGEEGIVGNMQRTGRSPEKWWGFKLV
LAYPRREVPWEAGKKIGDIDVLKGGGQVVVEFVTDEDAKSKGKSRSSLEQDDDDEYHTES
D
Download sequence
Identical sequences R7T0R7
XP_007365665.1.3125 jgi|Dicsq1|169986|gm1.5755_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]